Lineage for d1fs1b1 (1fs1 B:86-140)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507272Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1507273Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1507274Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1507281Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 1507282Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 1507283Domain d1fs1b1: 1fs1 B:86-140 [19252]
    Other proteins in same PDB: d1fs1a1, d1fs1b2, d1fs1c1, d1fs1d2

Details for d1fs1b1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (B:) cyclin a/cdk2-associated p45

SCOPe Domain Sequences for d1fs1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOPe Domain Coordinates for d1fs1b1:

Click to download the PDB-style file with coordinates for d1fs1b1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1b1: