| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
| Domain d1fs1b1: 1fs1 B:86-140 [19252] Other proteins in same PDB: d1fs1a1, d1fs1b2, d1fs1c1, d1fs1d2 |
PDB Entry: 1fs1 (more details), 1.8 Å
SCOPe Domain Sequences for d1fs1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
Timeline for d1fs1b1:
View in 3DDomains from other chains: (mouse over for more information) d1fs1a1, d1fs1c1, d1fs1d1, d1fs1d2 |