SCOPe 2.05: Domain d4h9qb_: 4h9q B:

Lineage for d4h9qb_ (4h9q B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (11 PDB entries)

8. Domain d4h9qb_: 4h9q B: [192511]
   Other proteins in same PDB: d4h9qa_
   automated match to d1kx5b_
   protein/DNA complex; complexed with po4

Details for d4h9qb_

PDB Entry: 4h9q, 1.95 Å

PDB Description: Complex structure 4 of DAXX(E225A)/H3.3(sub5)/H4

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d4h9qb_:

Sequence; same for both SEQRES and ATOM records:

>d4h9qb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d4h9qb_:

• d4h9qb_ first appeared in SCOPe 2.02
  
• d4h9qb_ appears in SCOPe 2.04
  
• d4h9qb_ appears in SCOPe 2.06
  
• d4h9qb_ appears in the current release, SCOPe 2.08