| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
| Domain d4h9qb_: 4h9q B: [192511] Other proteins in same PDB: d4h9qa_ automated match to d1kx5b_ protein/DNA complex; complexed with po4 |
PDB Entry: 4h9q (more details), 1.95 Å
SCOPe Domain Sequences for d4h9qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h9qb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg
Timeline for d4h9qb_: