Lineage for d1a6i_2 (1a6i 68-208)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins) Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (9 PDB entries) 
Domain d1a6i_2: 1a6i 68-208 [19243]
Other proteins in same PDB: d1a6i_1
Details for d1a6i_2
PDB Entry: 1a6i (more details), 2.4 Å
PDB Description: tet repressor, class d variant
SCOP Domain Sequences for d1a6i_2:
Sequence, based on SEQRES records: (download)
>d1a6i_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Sequence, based on observed residues (ATOM records): (download)
>d1a6i_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehlppllrealqimdsddgeqaflhgleslirgfevql
tallqiv
SCOP Domain Coordinates for d1a6i_2:
Click to download the PDB-style file with coordinates for d1a6i_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6i_2:
- d1a6i_2 first appeared (with stable ids) in SCOP 1.55
- d1a6i_2 appears in SCOP 1.57
- d1a6i_2 appears in SCOP 1.61
- d1a6i_2 appears in the current release, SCOPe 2.08, called d1a6ia2
View in 3D
