Lineage for d1a6i_2 (1a6i 68-208)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50800Fold a.121: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48497] (1 superfamily)
  4. 50801Superfamily a.121.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48498] (1 family) (S)
  5. 50802Family a.121.1.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48499] (1 protein)
  6. 50803Protein Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48500] (1 species)
  7. 50804Species Escherichia coli [TaxId:562] [48501] (9 PDB entries)
  8. 50807Domain d1a6i_2: 1a6i 68-208 [19243]
    Other proteins in same PDB: d1a6i_1

Details for d1a6i_2

PDB Entry: 1a6i (more details), 2.4 Å

PDB Description: tet repressor, class d variant

SCOP Domain Sequences for d1a6i_2:

Sequence, based on SEQRES records: (download)

>d1a6i_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1a6i_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehlppllrealqimdsddgeqaflhgleslirgfevql
tallqiv

SCOP Domain Coordinates for d1a6i_2:

Click to download the PDB-style file with coordinates for d1a6i_2.
(The format of our PDB-style files is described here.)

Timeline for d1a6i_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6i_1