Lineage for d4dgab_ (4dga B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553529Protein automated matches [190077] (17 species)
    not a true protein
  7. 1553592Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)
  8. 1553596Domain d4dgab_: 4dga B: [192321]
    Other proteins in same PDB: d4dgac_, d4dgad_
    automated match to d1w8ma_

Details for d4dgab_

PDB Entry: 4dga (more details), 1.9 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: HIV-1 CA(O-loop) complex
PDB Compounds: (B:) trimcyp

SCOPe Domain Sequences for d4dgab_:

Sequence, based on SEQRES records: (download)

>d4dgab_ b.62.1.1 (B:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Sequence, based on observed residues (ATOM records): (download)

>d4dgab_ b.62.1.1 (B:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthgksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewldgkh
vvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d4dgab_:

Click to download the PDB-style file with coordinates for d4dgab_.
(The format of our PDB-style files is described here.)

Timeline for d4dgab_: