Lineage for d3umsa1 (3ums A:61-181)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494816Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1494817Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1494818Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1494819Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1494844Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries)
  8. 1494846Domain d3umsa1: 3ums A:61-181 [192180]
    Other proteins in same PDB: d3umsa2
    complexed with cl, gdp, so4; mutant

Details for d3umsa1

PDB Entry: 3ums (more details), 2.34 Å

PDB Description: Crystal structure of the G202A mutant of human G-alpha-i1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d3umsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umsa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOPe Domain Coordinates for d3umsa1:

Click to download the PDB-style file with coordinates for d3umsa1.
(The format of our PDB-style files is described here.)

Timeline for d3umsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3umsa2