| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries) |
| Domain d3umsa1: 3ums A:61-181 [192180] Other proteins in same PDB: d3umsa2 complexed with cl, gdp, so4; mutant |
PDB Entry: 3ums (more details), 2.34 Å
SCOPe Domain Sequences for d3umsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umsa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
Timeline for d3umsa1: