Lineage for d3nqub_ (3nqu B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1726090Species Human (Homo sapiens) [TaxId:9606] [192456] (11 PDB entries)
  8. 1726102Domain d3nqub_: 3nqu B: [191902]
    Other proteins in same PDB: d3nqua_
    automated match to d1kx5b_
    complexed with so4

Details for d3nqub_

PDB Entry: 3nqu (more details), 2.5 Å

PDB Description: Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3nqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nqub_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalk

SCOPe Domain Coordinates for d3nqub_:

Click to download the PDB-style file with coordinates for d3nqub_.
(The format of our PDB-style files is described here.)

Timeline for d3nqub_: