SCOPe 2.08: Domain d3nqub_: 3nqu B:

Lineage for d3nqub_ (3nqu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)

8. Domain d3nqub_: 3nqu B: [191902]
   Other proteins in same PDB: d3nqua_
   automated match to d1kx5b_
   complexed with so4

Details for d3nqub_

PDB Entry: 3nqu, 2.5 Å

PDB Description: Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3nqub_:

Sequence; same for both SEQRES and ATOM records:

>d3nqub_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalk

Timeline for d3nqub_:

• d3nqub_ first appeared in SCOPe 2.02
  
• d3nqub_ appears in SCOPe 2.07