![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
![]() | Domain d3mnnf_: 3mnn F: [191787] Other proteins in same PDB: d3mnna_, d3mnnc_, d3mnnd_, d3mnne_, d3mnng_, d3mnnh_ automated match to d1kx5b_ protein/DNA complex; complexed with mg, mml, ptw, ru, so4 |
PDB Entry: 3mnn (more details), 2.5 Å
SCOPe Domain Sequences for d3mnnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mnnf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh akrktvtamdvvyalkrqgrtlygfgg
Timeline for d3mnnf_: