Lineage for d3gdjc_ (3gdj C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076761Protein automated matches [190359] (36 species)
    not a true protein
  7. 1076850Species Camel (Camelus dromedarius) [TaxId:9838] [189249] (1 PDB entry)
  8. 1076853Domain d3gdjc_: 3gdj C: [191712]
    automated match to d3gdja_
    complexed with hem

Details for d3gdjc_

PDB Entry: 3gdj (more details), 2 Å

PDB Description: crystal structure determination of camel(camelus dromedarius) hemoglobin at 2 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gdjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdjc_ a.1.1.2 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vlsskdktnvktafgkigghaaeygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltkaadhlddlpsalsalsdlhahklrvdpvnfkllshcllvtvaahhpgdftps
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3gdjc_:

Click to download the PDB-style file with coordinates for d3gdjc_.
(The format of our PDB-style files is described here.)

Timeline for d3gdjc_: