Lineage for d1iknd_ (1ikn D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006552Protein I-kappa-B-alpha [48417] (1 species)
  7. 3006553Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries)
  8. 3006554Domain d1iknd_: 1ikn D: [19171]
    Other proteins in same PDB: d1ikna1, d1ikna2, d1iknc_
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1iknd_

PDB Entry: 1ikn (more details), 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex
PDB Compounds: (D:) protein (I-kappa-b-alpha)

SCOPe Domain Sequences for d1iknd_:

Sequence, based on SEQRES records: (download)

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
dgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaeallg
agcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasi
hgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgys
pyqltwgrpstriqqqlgqltlenlqmlpesedeesydtes

Sequence, based on observed residues (ATOM records): (download)

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
dgdsflhlaiiheekaltmevirlaflnfqnnlqqtplhlavitnqpeiaeallgagcdp
elrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasihgylg
ivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgyspyqlt
wgrpstriqqqlgqltlenlqmlpesedeesydtes

SCOPe Domain Coordinates for d1iknd_:

Click to download the PDB-style file with coordinates for d1iknd_.
(The format of our PDB-style files is described here.)

Timeline for d1iknd_: