PDB entry 1ikn

View 1ikn on RCSB PDB site
Description: ikappabalpha/nf-kappab complex
Class: transcription factor
Keywords: transcription factor, ikb/nfkb complex
Deposited on 1998-11-13, released 1999-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nf-kappa-b p65 subunit)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ikna1, d1ikna2
  • Chain 'C':
    Compound: protein (nf-kappa-b p50d subunit)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iknc_
  • Chain 'D':
    Compound: protein (I-kappa-b-alpha)
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD-3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iknd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iknA (A:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iknA (A:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrataelkicrvn
    rnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppyadp
    slqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iknC (C:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeevqrkrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iknC (C:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iknD (D:)
    kqqltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpei
    aeallgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtc
    lhlasihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrv
    tyqgyspyqltwgrpstriqqqlgqltlenlqmlpesedeesydtesefteftede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iknD (D:)
    dgdsflhlaiiheekaltmevirlaflnfqnnlqqtplhlavitnqpeiaeallgagcdp
    elrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasihgylg
    ivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgyspyqlt
    wgrpstriqqqlgqltlenlqmlpesedeesydtes