Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein 53BP2 [48405] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48406] (1 PDB entry) |
Domain d1ycsb1: 1ycs B:327-456 [19155] Other proteins in same PDB: d1ycsa_, d1ycsb2 complexed with zn |
PDB Entry: 1ycs (more details), 2.2 Å
SCOPe Domain Sequences for d1ycsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq flygvqekmg
Timeline for d1ycsb1: