SCOPe 2.08: Domain d1ycsb1: 1ycs B:327-456

Lineage for d1ycsb1 (1ycs B:327-456)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein 53BP2 [48405] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48406] (1 PDB entry)

8. Domain d1ycsb1: 1ycs B:327-456 [19155]
   Other proteins in same PDB: d1ycsa_, d1ycsb2
   complexed with zn
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1ycsb1

PDB Entry: 1ycs, 2.2 Å

PDB Description: p53-53bp2 complex

PDB Compounds: (B:) 53bp2

SCOPe Domain Sequences for d1ycsb1:

Sequence; same for both SEQRES and ATOM records:

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}
plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv
naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq
flygvqekmg

Timeline for d1ycsb1:

• d1ycsb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ycsb1 appears in SCOPe 2.07