PDB entry 1ycs

View 1ycs on RCSB PDB site
Description: p53-53bp2 complex
Class: complex (anti-oncogene/ankyrin repeats)
Keywords: ankyrin repeats, sh3, p53, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism, complex (anti-oncogene/ankyrin repeats)
Deposited on 1996-09-30, released 1997-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p53
    Species: Homo sapiens [TaxId:9606]
    Gene: RESIDUES 291-529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycsa_
  • Chain 'B':
    Compound: 53bp2
    Species: Homo sapiens [TaxId:9606]
    Gene: RESIDUES 291-529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycsb1, d1ycsb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ycsA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycsA (A:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgrdrrteee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ycsB (B:)
    peitgqvslppgkrtnlrktgseriahgmrvkfnplplallldsslegefdlvqriiyev
    ddpslpndegitalhnavcaghteivkflvqfgvnvnaadsdgwtplhcaascnnvqvck
    flvesgaavfamtysdmqtaadkceemeegytqcsqflygvqekmgimnkgviyalwdye
    pqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllglyprikprqrsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycsB (B:)
    plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv
    naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq
    flygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndk
    egyvprnllglyp