Lineage for d1b89a_ (1b89 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006512Family a.118.1.3: Clathrin heavy chain proximal leg segment [48390] (1 protein)
  6. 2006513Protein Clathrin heavy chain proximal leg segment [48391] (1 species)
  7. 2006514Species Cow (Bos taurus) [TaxId:9913] [48392] (1 PDB entry)
  8. 2006515Domain d1b89a_: 1b89 A: [19138]

Details for d1b89a_

PDB Entry: 1b89 (more details), 2.6 Å

PDB Description: clathrin heavy chain proximal leg segment (bovine)
PDB Compounds: (A:) protein (clathrin heavy chain)

SCOPe Domain Sequences for d1b89a_:

Sequence, based on SEQRES records: (download)

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}
rlaeleefingpnnahiqqvgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaav
dgarkanstrtwkevcfacvdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelit
mleaalglerahmgmftelailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwael
vflydkyeeydnaiitmmnhptdawkegqfkdiitkvanvelyyraiqfylefkplllnd
llmvlsprldhtravnyfskvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalr
tsidaydnfdnislaqrlekheliefrriaaylfkg

Sequence, based on observed residues (ATOM records): (download)

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}
rlaeleefingpnmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkev
cfacvdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgm
ftelailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaii
tmmnhptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtrav
nyfskvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnisla
qrlekheliefrriaaylfkg

SCOPe Domain Coordinates for d1b89a_:

Click to download the PDB-style file with coordinates for d1b89a_.
(The format of our PDB-style files is described here.)

Timeline for d1b89a_: