Lineage for d1grnb_ (1grn B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284863Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 284864Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) (S)
  5. 284865Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins)
  6. 284866Protein Cdc42GAP [48356] (1 species)
  7. 284867Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries)
  8. 284869Domain d1grnb_: 1grn B: [19106]
    Other proteins in same PDB: d1grna_
    complexed with gdp, mg

Details for d1grnb_

PDB Entry: 1grn (more details), 2.1 Å

PDB Description: crystal structure of the cdc42/cdc42gap/alf3 complex.

SCOP Domain Sequences for d1grnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grnb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens)}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfps

SCOP Domain Coordinates for d1grnb_:

Click to download the PDB-style file with coordinates for d1grnb_.
(The format of our PDB-style files is described here.)

Timeline for d1grnb_: