Lineage for d1grnb_ (1grn B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) 
Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins) 
Protein Cdc42GAP [48356] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries) 
Domain d1grnb_: 1grn B: [19106]
Other proteins in same PDB: d1grna_
Details for d1grnb_
PDB Entry: 1grn (more details), 2.1 Å
PDB Description: crystal structure of the cdc42/cdc42gap/alf3 complex.
SCOP Domain Sequences for d1grnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grnb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens)}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfps
SCOP Domain Coordinates for d1grnb_:
Click to download the PDB-style file with coordinates for d1grnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1grnb_:
- d1grnb_ appears in SCOP 1.57
- d1grnb_ appears in the current release, SCOPe 2.08
View in 3D
