SCOPe 2.08: Domain d1grnb_: 1grn B:

Lineage for d1grnb_ (1grn B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
   Pfam PF00620

6. Protein Cdc42GAP [48356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries)

8. Domain d1grnb_: 1grn B: [19106]
   Other proteins in same PDB: d1grna_
   complexed with af3, gdp, mg

Details for d1grnb_

PDB Entry: 1grn, 2.1 Å

PDB Description: crystal structure of the cdc42/cdc42gap/alf3 complex.

PDB Compounds: (B:) protein (rho gtpase activating protein)

SCOPe Domain Sequences for d1grnb_:

Sequence; same for both SEQRES and ATOM records:

>d1grnb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens) [TaxId: 9606]}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfps

Timeline for d1grnb_:

• d1grnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1grnb_ appears in SCOPe 2.07