SCOPe 2.05: Domain d1bvp11: 1bvp 1:1-120,1:255-349

Lineage for d1bvp11 (1bvp 1:1-120,1:255-349)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
   multihelical; three-helical bundle in the core is surrounded by non-conserved helices

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families)
   this domain is interrupted by a jelly-roll beta-sandwich domain

5. Family a.115.1.1: Orbivirus capsid [48346] (1 protein)

6. Protein BTV vp7 [48347] (1 species)

7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)

8. Domain d1bvp11: 1bvp 1:1-120,1:255-349 [19079]
   Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp11

PDB Entry: 1bvp, 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

PDB Compounds: (1:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp11:

Sequence; same for both SEQRES and ATOM records:

>d1bvp11 a.115.1.1 (1:1-120,1:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

Timeline for d1bvp11:

• d1bvp11 first appeared (with stable ids) in SCOP 1.55
  
• d1bvp11 appears in SCOPe 2.04
  
• d1bvp11 appears in SCOPe 2.06
  
• d1bvp11 appears in the current release, SCOPe 2.08