Lineage for d1bvp41 (1bvp 4:1-120,4:255-349)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1744978Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 1744979Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 1744980Family a.115.1.1: Orbivirus capsid [48346] (1 protein)
  6. 1744981Protein BTV vp7 [48347] (1 species)
  7. 1744982Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 1744986Domain d1bvp41: 1bvp 4:1-120,4:255-349 [19082]
    Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp41

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7
PDB Compounds: (4:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp41:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp41 a.115.1.1 (4:1-120,4:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

SCOPe Domain Coordinates for d1bvp41:

Click to download the PDB-style file with coordinates for d1bvp41.
(The format of our PDB-style files is described here.)

Timeline for d1bvp41: