Lineage for d1ewra1 (1ewr A:267-541)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006154Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2006155Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 2006156Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 2006157Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 2006174Species Thermus aquaticus [TaxId:271] [48337] (4 PDB entries)
  8. 2006181Domain d1ewra1: 1ewr A:267-541 [19073]
    Other proteins in same PDB: d1ewra2, d1ewra3, d1ewrb2, d1ewrb3

Details for d1ewra1

PDB Entry: 1ewr (more details), 3.19 Å

PDB Description: crystal structure of taq muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ewra1:

Sequence, based on SEQRES records: (download)

>d1ewra1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yrladlerlatrlelgraspkdlgalrrslqilpelrallgeevglpdlsplkeeleaal
vedpplkvseggliregydpdldalraahregvayfleleererertgiptlkvgynavf
gyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekerevyrlealirrreeevflev
rerakrqaealreaarilaeldvyaalaevavryg

Sequence, based on observed residues (ATOM records): (download)

>d1ewra1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yelgraspkdlgalreaarilaeldvyaalaevavryg

SCOPe Domain Coordinates for d1ewra1:

Click to download the PDB-style file with coordinates for d1ewra1.
(The format of our PDB-style files is described here.)

Timeline for d1ewra1: