![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
![]() | Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
![]() | Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries) |
![]() | Domain d1ewrb2: 1ewr B:1542-1762 [32388] Other proteins in same PDB: d1ewra1, d1ewra3, d1ewrb1, d1ewrb3 |
PDB Entry: 1ewr (more details), 3.19 Å
SCOPe Domain Sequences for d1ewrb2:
Sequence, based on SEQRES records: (download)
>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg lvfyhqvlpgpasksygvevaamaglpkevvararallqam
>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq vlpgpasksygvevaamaglpkevvararallqam
Timeline for d1ewrb2: