SCOPe 2.08: Domain d1ewrb2: 1ewr B:1542-1762

Lineage for d1ewrb2 (1ewr B:1542-1762)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)

8. Domain d1ewrb2: 1ewr B:1542-1762 [32388]
   Other proteins in same PDB: d1ewra1, d1ewra3, d1ewrb1, d1ewrb3

Details for d1ewrb2

PDB Entry: 1ewr, 3.19 Å

PDB Description: crystal structure of taq muts

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ewrb2:

Sequence, based on SEQRES records:

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam

Sequence, based on observed residues (ATOM records):

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam

Timeline for d1ewrb2:

• d1ewrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ewrb2 appears in SCOPe 2.07