| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
| Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
| Protein Cyp119 [48278] (2 species) thermophilic P450 |
| Species Sulfolobus solfataricus [TaxId:2287] [48279] (5 PDB entries) |
| Domain d1io7a_: 1io7 A: [18971] complexed with hem |
PDB Entry: 1io7 (more details), 1.5 Å
SCOPe Domain Sequences for d1io7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io7a_ a.104.1.1 (A:) Cyp119 {Sulfolobus solfataricus [TaxId: 2287]}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlks
Timeline for d1io7a_: