Lineage for d1ehga_ (1ehg A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (27 PDB entries)
    Uniprot P23295
  8. Domain d1ehga_: 1ehg A: [18956]
    complexed with hem; mutant

Details for d1ehga_

PDB Entry: 1ehg (more details), 1.7000000000000002 Å

PDB Description: crystal structures of cytochrome p450nor and its mutants (ser286 val, thr) in the ferric resting state at cryogenic temperature: a comparative analysis with monooxygenase cytochrome p450s
PDB Compounds: (A:) cytochrome p450nor

SCOPe Domain Sequences for d1ehga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehga_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d1ehga_ are not available.

Timeline for d1ehga_: