PDB entry 1ehg

View 1ehg on RCSB PDB site
Description: crystal structures of cytochrome p450nor and its mutants (ser286 val, thr) in the ferric resting state at cryogenic temperature: a comparative analysis with monooxygenase cytochrome p450s
Class: oxidoreductase
Keywords: nitric oxide reductase, Cytochrome P450nor, OXIDOREDUCTASE
Deposited on 2000-02-21, released 2000-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450nor
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23295 (Start-402)
      • engineered (285)
    Domains in SCOPe 2.07: d1ehga_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehgA (A:)
    masgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekl
    skvrtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrt
    vddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsst
    areasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvag
    natmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmi
    gdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlaka
    elttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehgA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif