| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
| Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
| Protein Cytochrome P450-CAM [48266] (1 species) |
| Species Pseudomonas putida [TaxId:303] [48267] (121 PDB entries) Uniprot P00183 |
| Domain d1dz9a_: 1dz9 A: [18918] complexed with cam, hem, k, o, trs |
PDB Entry: 1dz9 (more details), 1.9 Å
SCOPe Domain Sequences for d1dz9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1dz9a_: