PDB entry 1dz9

View 1dz9 on RCSB PDB site
Description: Putative oxo complex of P450cam from Pseudomonas putida
Class: oxidoreductase
Keywords: oxidoreductase, mono-oxygenase, heme, reaction intermediate
Deposited on 2000-02-18, released 2000-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dz9a_
  • Chain 'B':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dz9b_
  • Heterogens: HEM, O, CAM, TRS, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dz9A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dz9A (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
    ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dz9B (B:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dz9B (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav