SCOP 1.71: Domain d1aj8a_: 1aj8 A:

Lineage for d1aj8a_ (1aj8 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [48261] (1 PDB entry)

8. Domain d1aj8a_: 1aj8 A: [18900]

Details for d1aj8a_

PDB Entry: 1aj8, 1.9 Å

PDB Description: citrate synthase from pyrococcus furiosus

SCOP Domain Sequences for d1aj8a_:

Sequence; same for both SEQRES and ATOM records:

>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Archaeon Pyrococcus furiosus}
lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele
nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig
isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily
aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee
wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk
gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei
gkkylpielrr

Timeline for d1aj8a_:

• d1aj8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1aj8a_ appears in SCOP 1.69
  
• d1aj8a_ appears in SCOP 1.73
  
• d1aj8a_ appears in the current release, SCOPe 2.08