Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein Citrate synthase [48258] (7 species) |
Species Pyrococcus furiosus [TaxId:2261] [48261] (1 PDB entry) |
Domain d1aj8a_: 1aj8 A: [18900] complexed with cit, coa |
PDB Entry: 1aj8 (more details), 1.9 Å
SCOPe Domain Sequences for d1aj8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Pyrococcus furiosus [TaxId: 2261]} lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei gkkylpielrr
Timeline for d1aj8a_: