SCOP 1.71: Domain d1aj8b_: 1aj8 B:

Lineage for d1aj8b_ (1aj8 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [48261] (1 PDB entry)

8. Domain d1aj8b_: 1aj8 B: [18901]
   complexed with cit, coa

Details for d1aj8b_

PDB Entry: 1aj8, 1.9 Å

PDB Description: citrate synthase from pyrococcus furiosus

SCOP Domain Sequences for d1aj8b_:

Sequence; same for both SEQRES and ATOM records:

>d1aj8b_ a.103.1.1 (B:) Citrate synthase {Archaeon Pyrococcus furiosus}
lakgledvyidqtnicyidgkegklyyrgysveelaelstfeevvyllwwgklpslsele
nfkkelaksrglpkevieimealpknthpmgalrtiisylgniddsgdipvtpeevyrig
isvtakiptivanwyrikngleyvppkeklshaanflymlhgeeppkewekamdvalily
aeheinastlavmtvgstlsdyysailagigalkgpihggaveeaikqfmeigspekvee
wffkalqqkrkimgaghrvyktydprarifkkyasklgdkklfeiaerlerlveeylskk
gisinvdywsglvfygmkipielyttifamgriagwtahlaeyvshnriirprlqyvgei
gkkylpielr

Timeline for d1aj8b_:

• d1aj8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1aj8b_ appears in SCOP 1.69
  
• d1aj8b_ appears in SCOP 1.73
  
• d1aj8b_ appears in the current release, SCOPe 2.08