SCOP 1.63: Domain d1csh__: 1csh -

Lineage for d1csh__ (1csh -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)

8. Domain d1csh__: 1csh - [18880]
   complexed with amx, oaa

Details for d1csh__

PDB Entry: 1csh, 1.6 Å

PDB Description: a very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor complex of citrate synthase

SCOP Domain Sequences for d1csh__:

Sequence; same for both SEQRES and ATOM records:

>d1csh__ a.103.1.1 (-) Citrate synthase {Chicken (Gallus gallus)}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

Timeline for d1csh__:

• d1csh__ first appeared (with stable ids) in SCOP 1.55
  
• d1csh__ appears in SCOP 1.61
  
• d1csh__ appears in SCOP 1.65
  
• d1csh__ appears in the current release, SCOPe 2.08, called d1csha_