Lineage for d1csha_ (1csh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2722949Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)
  8. 2722950Domain d1csha_: 1csh A: [18880]
    complexed with amx, oaa

Details for d1csha_

PDB Entry: 1csh (more details), 1.65 Å

PDB Description: a very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor complex of citrate synthase
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1csha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csha_ a.103.1.1 (A:) Citrate synthase {Chicken (Gallus gallus) [TaxId: 9031]}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

SCOPe Domain Coordinates for d1csha_:

Click to download the PDB-style file with coordinates for d1csha_.
(The format of our PDB-style files is described here.)

Timeline for d1csha_: