SCOP 1.65: Domain d1d8eb_: 1d8e B:

Lineage for d1d8eb_ (1d8e B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (17 PDB entries)

8. Domain d1d8eb_: 1d8e B: [18869]
   Other proteins in same PDB: d1d8ea_
   complex with k-ras4b peptide substrate and FPP analog
   complexed with ace, fii

Details for d1d8eb_

PDB Entry: 1d8e, 3 Å

PDB Description: Zinc-depleted FTase complexed with K-RAS4B peptide substrate and FPP analog.

SCOP Domain Sequences for d1d8eb_:

Sequence; same for both SEQRES and ATOM records:

>d1d8eb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1d8eb_:

• d1d8eb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d8eb_ appears in SCOP 1.63
  
• d1d8eb_ appears in SCOP 1.67
  
• d1d8eb_ appears in the current release, SCOPe 2.08