Class a: All alpha proteins [46456] (179 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array |
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (17 PDB entries) |
Domain d1d8eb_: 1d8e B: [18869] Other proteins in same PDB: d1d8ea_ complex with k-ras4b peptide substrate and FPP analog complexed with ace, fii |
PDB Entry: 1d8e (more details), 3 Å
SCOP Domain Sequences for d1d8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8eb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)} pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
Timeline for d1d8eb_: