Lineage for d1d8eb_ (1d8e B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5654Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) (S)
  5. 5676Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 5677Protein Protein farnesyltransferase, beta-subunit [48247] (1 species)
  7. 5678Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (6 PDB entries)
  8. 5682Domain d1d8eb_: 1d8e B: [18869]
    Other proteins in same PDB: d1d8ea_

Details for d1d8eb_

PDB Entry: 1d8e (more details), 3 Å

PDB Description: Zinc-depleted FTase complexed with K-RAS4B peptide substrate and FPP analog.

SCOP Domain Sequences for d1d8eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8eb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOP Domain Coordinates for d1d8eb_:

Click to download the PDB-style file with coordinates for d1d8eb_.
(The format of our PDB-style files is described here.)

Timeline for d1d8eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d8ea_