Lineage for d1d8eb_ (1d8e B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (6 PDB entries) 
Domain d1d8eb_: 1d8e B: [18869]
Other proteins in same PDB: d1d8ea_
Details for d1d8eb_
PDB Entry: 1d8e (more details), 3 Å
PDB Description: Zinc-depleted FTase complexed with K-RAS4B peptide substrate and FPP analog.
SCOP Domain Sequences for d1d8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8eb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
SCOP Domain Coordinates for d1d8eb_:
Click to download the PDB-style file with coordinates for d1d8eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8eb_:
- d1d8eb_ appears in SCOP 1.57
- d1d8eb_ appears in the current release, SCOPe 2.07
View in 3D
