Lineage for d1d8eb_ (1d8e B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
Uniprot Q02293 22-418 P53610
Domain d1d8eb_: 1d8e B: [18869]
Other proteins in same PDB: d1d8ea_
complex with k-ras4b peptide substrate and FPP analog
complexed with act, fii
Details for d1d8eb_
PDB Entry: 1d8e (more details), 3 Å
PDB Description: Zinc-depleted FTase complexed with K-RAS4B peptide substrate and FPP analog.
PDB Compounds: (B:) farnesyltranserase (beta subunit)SCOPe Domain Sequences for d1d8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8eb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
SCOPe Domain Coordinates for d1d8eb_:
Click to download the PDB-style file with coordinates for d1d8eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8eb_:
- d1d8eb_ first appeared (with stable ids) in SCOP 1.55
- d1d8eb_ appears in SCOPe 2.07
View in 3D
