Class a: All alpha proteins [46456] (226 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.2: Terpene synthases [48243] (2 proteins) consists of two toroid domains: one of six and one of five hairpins |
Protein Squalene-hopene cyclase [48244] (1 species) |
Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
Domain d2sqca1: 2sqc A:8-36,A:308-630 [18854] |
PDB Entry: 2sqc (more details), 2 Å
SCOP Domain Sequences for d2sqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius} apayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkag ewlldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrr damtkgfrwivgmqssnggwgaydvdntsdlpnhipfsdfgevtdppsedvtahvlecfg sfgyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiq kaldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrg vqylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaier
Timeline for d2sqca1: