![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.2: Terpene synthases [48243] (3 proteins) consists of two toroid domains: one of six and one of five hairpins |
![]() | Protein Squalene-hopene cyclase [48244] (1 species) |
![]() | Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
![]() | Domain d2sqca1: 2sqc A:8-36,A:308-630 [18854] complexed with c8e |
PDB Entry: 2sqc (more details), 2 Å
SCOPe Domain Sequences for d2sqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} apayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkag ewlldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrr damtkgfrwivgmqssnggwgaydvdntsdlpnhipfsdfgevtdppsedvtahvlecfg sfgyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiq kaldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrg vqylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaier
Timeline for d2sqca1: