Lineage for d2sqca1 (2sqc A:8-36,A:308-630)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5654Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) (S)
  5. 5661Family a.102.4.2: Terpene syntases [48243] (1 protein)
  6. 5662Protein Squalene-hopene cyclase [48244] (1 species)
  7. 5663Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (3 PDB entries)
  8. 5664Domain d2sqca1: 2sqc A:8-36,A:308-630 [18854]

Details for d2sqca1

PDB Entry: 2sqc (more details), 2 Å

PDB Description: squalene-hopene cyclase from alicyclobacillus acidocaldarius

SCOP Domain Sequences for d2sqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
apayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkag
ewlldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrr
damtkgfrwivgmqssnggwgaydvdntsdlpnhipfsdfgevtdppsedvtahvlecfg
sfgyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiq
kaldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrg
vqylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaier

SCOP Domain Coordinates for d2sqca1:

Click to download the PDB-style file with coordinates for d2sqca1.
(The format of our PDB-style files is described here.)

Timeline for d2sqca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sqca2