Lineage for d1fmia1 (1fmi A:243-697)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004342Species Human (Homo sapiens) [TaxId:9606] [48229] (6 PDB entries)
  8. 2004345Domain d1fmia1: 1fmi A:243-697 [18846]
    Other proteins in same PDB: d1fmia2
    complexed with ca, so4

Details for d1fmia1

PDB Entry: 1fmi (more details), 1.9 Å

PDB Description: crystal structure of human class i alpha1,2-mannosidase
PDB Compounds: (A:) endoplasmic reticulum alpha-mannosidase I

SCOPe Domain Sequences for d1fmia1:

Sequence, based on SEQRES records: (download)

>d1fmia1 a.102.2.1 (A:243-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilg
lrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrl
mpafrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeave
kvtqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetq
lledyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglp
ashmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetve
slfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflg
etlkylfllfsddpnllsldayvfnteahplpiwt

Sequence, based on observed residues (ATOM records): (download)

>d1fmia1 a.102.2.1 (A:243-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilg
lrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrl
mpafrtpskipysdvnigtgvahpprsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnteahplpiwt

SCOPe Domain Coordinates for d1fmia1:

Click to download the PDB-style file with coordinates for d1fmia1.
(The format of our PDB-style files is described here.)

Timeline for d1fmia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fmia2