Lineage for d1clca1 (1clc A:135-575)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004085Protein CelD cellulase, C-terminal domain [48218] (1 species)
    the other, N-terminal, domain is immunoglobulin-like
  7. 2004086Species Clostridium thermocellum [TaxId:1515] [48219] (1 PDB entry)
  8. 2004087Domain d1clca1: 1clc A:135-575 [18835]
    Other proteins in same PDB: d1clca2
    complexed with ca, zn

Details for d1clca1

PDB Entry: 1clc (more details), 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution
PDB Compounds: (A:) endoglucanase celd; ec: 3.2.1.4

SCOPe Domain Sequences for d1clca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}
amnvyedafktamlgmyllrcgtsvsatyngihyshgpchtndayldyingqhtkkdstk
gwhdagdynkyvvnagitvgsmflawehfkdqlepvaleipeknnsipdfldelkyeidw
iltmqypdgsgrvahkvstrnfggfimpenehderffvpwssaatadfvamtamaarifr
pydpqyaekcinaakvsyeflknnpanvfanqsgfstgeyatvsdaddrlwaaaemwetl
gdeeylrdfenraaqfskkieadfdwdnvanlgmftyllserpgknpalvqsikdsllst
adsivrtsqnhgygrtlgttyywgcngtvvrqtmilqvankispnndyvnaaldaishvf
grnyynrsyvtglginppmnphdrrsgadgiwepwpgylvgggwpgpkdwvdiqdsyqtn
eiainwnaaliyalagfvnyn

SCOPe Domain Coordinates for d1clca1:

Click to download the PDB-style file with coordinates for d1clca1.
(The format of our PDB-style files is described here.)

Timeline for d1clca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clca2