Class a: All alpha proteins [46456] (285 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species) Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI |
Species Pig (Sus scrofa) [TaxId:9823] [48190] (1 PDB entry) |
Domain d3hdha1: 3hdh A:204-302 [18805] Other proteins in same PDB: d3hdha2, d3hdhb2, d3hdhc2 complexed with nad |
PDB Entry: 3hdh (more details), 2.8 Å
SCOPe Domain Sequences for d3hdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdha1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} gfivnrllvpylieavrlyergdaskedidtamklgagypmgpfelldyvgldttkfiid gwhemdsqnplfqpspamnklvaenkfgkktgegfykyk
Timeline for d3hdha1:
View in 3D Domains from other chains: (mouse over for more information) d3hdhb1, d3hdhb2, d3hdhc1, d3hdhc2 |