Lineage for d3hdha1 (3hdh A:204-302)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742471Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 1742490Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 1742514Species Pig (Sus scrofa) [TaxId:9823] [48190] (1 PDB entry)
  8. 1742515Domain d3hdha1: 3hdh A:204-302 [18805]
    Other proteins in same PDB: d3hdha2, d3hdhb2, d3hdhc2
    complexed with nad

Details for d3hdha1

PDB Entry: 3hdh (more details), 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination
PDB Compounds: (A:) protein (l-3-hydroxyacyl coa dehydrogenase)

SCOPe Domain Sequences for d3hdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdha1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
gfivnrllvpylieavrlyergdaskedidtamklgagypmgpfelldyvgldttkfiid
gwhemdsqnplfqpspamnklvaenkfgkktgegfykyk

SCOPe Domain Coordinates for d3hdha1:

Click to download the PDB-style file with coordinates for d3hdha1.
(The format of our PDB-style files is described here.)

Timeline for d3hdha1: