SCOP 1.63: Domain d6r1rb1: 6r1r B:1-221

Lineage for d6r1rb1 (6r1r B:1-221)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d6r1rb1: 6r1r B:1-221 [18761]
   Other proteins in same PDB: d6r1ra2, d6r1rb2, d6r1rc2

Details for d6r1rb1

PDB Entry: 6r1r, 3.1 Å

PDB Description: ribonucleotide reductase e441d mutant r1 protein from escherichia coli

SCOP Domain Sequences for d6r1rb1:

Sequence; same for both SEQRES and ATOM records:

>d6r1rb1 a.98.1.1 (B:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d6r1rb1:

• d6r1rb1 first appeared (with stable ids) in SCOP 1.55
  
• d6r1rb1 appears in SCOP 1.61
  
• d6r1rb1 appears in SCOP 1.65
  
• d6r1rb1 appears in the current release, SCOPe 2.08