Lineage for d6r1rb1 (6r1r B:1-221)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284084Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 284085Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 284086Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 284087Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)
  7. 284088Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 284097Domain d6r1rb1: 6r1r B:1-221 [18761]
    Other proteins in same PDB: d6r1ra2, d6r1rb2, d6r1rc2

Details for d6r1rb1

PDB Entry: 6r1r (more details), 3.1 Å

PDB Description: ribonucleotide reductase e441d mutant r1 protein from escherichia coli

SCOP Domain Sequences for d6r1rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r1rb1 a.98.1.1 (B:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d6r1rb1:

Click to download the PDB-style file with coordinates for d6r1rb1.
(The format of our PDB-style files is described here.)

Timeline for d6r1rb1: