Lineage for d1apxa_ (1apx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719960Protein Ascorbate peroxidase [48123] (3 species)
  7. 2719961Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry)
  8. 2719962Domain d1apxa_: 1apx A: [18669]
    complexed with hem, k

Details for d1apxa_

PDB Entry: 1apx (more details), 2.2 Å

PDB Description: crystal structure of recombinant ascorbate peroxidase
PDB Compounds: (A:) cytosolic ascorbate peroxidase

SCOPe Domain Sequences for d1apxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apxa_ a.93.1.1 (A:) Ascorbate peroxidase {Pea (Pisum sativum) [TaxId: 3888]}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea

SCOPe Domain Coordinates for d1apxa_:

Click to download the PDB-style file with coordinates for d1apxa_.
(The format of our PDB-style files is described here.)

Timeline for d1apxa_: