![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein Ascorbate peroxidase [48123] (3 species) |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry) |
![]() | Domain d1apxb_: 1apx B: [18670] complexed with hem, k |
PDB Entry: 1apx (more details), 2.2 Å
SCOPe Domain Sequences for d1apxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apxb_ a.93.1.1 (B:) Ascorbate peroxidase {Pea (Pisum sativum) [TaxId: 3888]} gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk lselgfaea
Timeline for d1apxb_: